DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc20

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_006252134.1 Gene:Zdhhc20 / 305923 RGDID:1305755 Length:444 Species:Rattus norvegicus


Alignment Length:221 Identity:46/221 - (20%)
Similarity:82/221 - (37%) Gaps:76/221 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QIFGWLVLLLFGVASYW------------------------VLIPAFHARIQGPLYGLITGLYLV 154
            ::.||:.:|.......|                        |.:.|||.            .:::
  Rat    71 RVVGWVPVLFITFVVVWSYYAYVVELCVSTVSRTGEKGKTVVYLVAFHL------------FFVM 123

  Fly   155 HIASHLTALLTDPA--DKELRRVH-RNDRIVPEFDRSKHSHVIENGR----------------CH 200
            .:.|:...:.|.||  .||....: ..:|...||.:.:...::....                |.
  Rat   124 FVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARDLPVYTTSASKAIRYCE 188

  Fly   201 LCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQI 265
            .|.: ...:|..|||.|::||.|.||||.|:|:|:|..||..|::.::.:::..|.:.|.|:.  
  Rat   189 KCQL-IKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLLYCLFVAATVLE-- 250

  Fly   266 VFYYIQPDWLSFYW----------CP 281
              |:|:      :|          ||
  Rat   251 --YFIK------FWTLCRRKSTENCP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 29/93 (31%)
Zdhhc20XP_006252134.1 zf-DHHC 75..380 CDD:303066 45/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.