DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:189 Identity:51/189 - (26%)
Similarity:82/189 - (43%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GLQLPLHPLQIFGWLVL----LLFGVASY-------WV-----LIPA---FHARIQGPLYGLITG 150
            ||:.||.......|.:|    :|..:|::       ||     |||:   .:....|.::.|:..
  Rat    16 GLETPLQTPNQRCWFILDPIGILCAMATWALVLSGGWVLVRDLLIPSNNMLYIVANGMIFHLLAS 80

  Fly   151 LYLVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCS 215
            |.||   |||..:||||..            ||..:|.....|   ..|..|. .....|..||:
  Rat    81 LALV---SHLRTMLTDPGS------------VPLGNRPGPDTV---SYCPDCR-SAIPKRAAHCA 126

  Fly   216 VCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDW 274
            ||.:|:.|.||||.|:|:|:|..|...||:.::...::...::..:...::..|.:.:|
  Rat   127 VCKRCIRKNDHHCPWVNNCVGEDNQKYFLLFIMYIGLSGTHVLLLLGIPVLCSYARGEW 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 22/76 (29%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.