DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001034189.1 Gene:Zdhhc24 / 293665 RGDID:1565630 Length:284 Species:Rattus norvegicus


Alignment Length:358 Identity:77/358 - (21%)
Similarity:119/358 - (33%) Gaps:127/358 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 WLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALL--------TDPADKELRR 174
            |..:::..:....||.|.     ..||..|...|.|...|..|..||        :||:.:.:..
  Rat    25 WAAVVVLELTYVMVLGPG-----PPPLEPLARALQLALAAYQLLNLLGNMGLFLRSDPSIRGVML 84

  Fly   175 VHRNDRIVPEFDRSKHSHVIENG--RCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGS 237
            ..|.               :..|  .|:.|..:... |:.|||.|..|:.:.||||:.|..|:|.
  Rat    85 AGRG---------------LGQGWAYCYQCQSQVPP-RSGHCSACRVCILRRDHHCRLLGRCVGF 133

  Fly   238 RNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSLSN 302
            .||..||..::.|                                       :|..::|::.||.
  Rat   134 HNYRPFLCLLLHA---------------------------------------AGVLLHISVLLSP 159

  Fly   303 GTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAIIEASATRPGISPTNHTETQPVVT 367
            ....|::.|::...|            .:..||.|:                          ::|
  Rat   160 ALSALLQAHSALYTV------------ALLLLPWLM--------------------------LLT 186

  Fly   368 G-IGLNETIFMFLLG--VLGLLAAVSAGLLLHLCFFHIYISFLGLTTYEYIRNHRQAQDAKTKQL 429
            | :.|.:....|::.  |.|.|.. .||||     ||..:...|.||:|:.|. :.:.|......
  Rat   187 GKVSLAQFALAFVVDTCVAGALLC-GAGLL-----FHGMLLLRGQTTWEWARG-QHSYDLGMSHN 244

  Fly   430 LEGAPGVRAPKNGNVHFSASLPEPHNPSKSLPG 462
            |:.|.|   |:...|.|...|..|      |||
  Rat   245 LQAALG---PRWALVWFWPFLASP------LPG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 20/82 (24%)
Zdhhc24NP_001034189.1 zf-DHHC 95..234 CDD:279823 48/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.