DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:197 Identity:57/197 - (28%)
Similarity:80/197 - (40%) Gaps:51/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QLPLHPLQIF----------GWLVL---LLFGVASYWV------LIPAFHARIQGPLYGLITGLY 152
            |||..||..|          ..||.   |.||....|:      :.||    :.|||: ::|...
  Rat    19 QLPEIPLSWFFPSLFAAFNVSLLVFLSGLFFGFPCRWLVQNGEWVFPA----VTGPLF-ILTFFS 78

  Fly   153 LVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSHVIE-NGR------CHLCNIRTSSNR 210
            ||.:.      .:||.......|..:.|.|         ||:. |.|      |..|...... |
  Rat    79 LVSLN------FSDPGILHRGSVSEDPRTV---------HVVRVNQRAFRLEWCPKCLFHRPP-R 127

  Fly   211 TKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWL 275
            |.||..||.||..|||||||:|:|||.||:..|::.::...:.:    .|::...:.:.|....|
  Rat   128 TYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFVLLILFLCLYS----GALLVTCLMFLIHTSHL 188

  Fly   276 SF 277
            .|
  Rat   189 PF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/79 (35%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.