DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and ZDHHC22

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001351101.1 Gene:ZDHHC22 / 283576 HGNCID:20106 Length:263 Species:Homo sapiens


Alignment Length:129 Identity:38/129 - (29%)
Similarity:61/129 - (47%) Gaps:26/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VIEN-----GRCHLCNIRTS---SNRTKHCSVCNKCVGKFDHHCKWLNHCIGS---RNYVAF--- 243
            ||:|     |.|...:.|.:   |..|..|.||.:...:.||||.:..:||||   ||:|.|   
Human    68 VIQNSPDDLGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFVLFCLY 132

  Fly   244 --LMCVVSAVVATLVIVAAVVA-----QIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSL 300
              |.|:.| :||.:..::||::     .:.|..:.|..:|.::    |...:.|..|:.:.|.|
Human   133 TSLACLYS-MVAGVAYISAVLSISFAHPLAFLTLLPTSISQFF----SGAVLGSEMFVILMLYL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 29/98 (30%)
ZDHHC22NP_001351101.1 DHHC 92..218 CDD:366691 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.