DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:209 Identity:44/209 - (21%)
Similarity:79/209 - (37%) Gaps:66/209 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QIFGWLVLLLFGVASYW------------------------VLIPAFHARIQGPLYGLITGLYLV 154
            ::.||:.:|.......|                        |.:.|||.            .:::
Human    12 RVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHL------------FFVM 64

  Fly   155 HIASHLTALLTDPA--DKELRRVH-RNDRIVPEFDRSKHSHVIENGR----------------CH 200
            .:.|:...:.|.||  .||....: ..:|...||.:.:...::....                |.
Human    65 FVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCE 129

  Fly   201 LCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQI 265
            .|.: ...:|..|||.|:.|:.|.||||.|:|:|:|..||..||:.::.:::..|.:.|.|:.  
Human   130 KCQL-IKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLE-- 191

  Fly   266 VFYYIQPDWLSFYW 279
              |:|:      :|
Human   192 --YFIK------FW 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 27/81 (33%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 43/205 (21%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.