DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_659564.3 Gene:Zdhhc2 / 246326 RGDID:628681 Length:366 Species:Rattus norvegicus


Alignment Length:212 Identity:50/212 - (23%)
Similarity:88/212 - (41%) Gaps:50/212 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VQHRKGRRLHGLQLPLHPLQIFGW---------LVLLLFGVASYWVLIPAFHARIQGPLYGLITG 150
            |:.|..|.|:.:.:....| :.||         .::.:..:....|.:.|:|.            
  Rat     9 VRRRCRRVLYWIPVVFISL-LLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHL------------ 60

  Fly   151 LYLVHIASHLTALLTDP-----------ADKELRR-----------VHRNDRIVPEFDRSKHSHV 193
            |:.:.:.|:...:.|.|           |:|||..           :.|..:.:|.:.|:....:
  Rat    61 LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAI 125

  Fly   194 IENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIV 258
            ....||.|    ...:|..|||||:||:.|.||||.|:|:|:|..||..||:.:..:::..|.|.
  Rat   126 RYCDRCRL----IKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIA 186

  Fly   259 AAVVAQIVFYYIQ--PD 273
            |..:...:.::..  ||
  Rat   187 ATDLQYFIRFWTNGLPD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/77 (36%)
Zdhhc2NP_659564.3 DHHC 19..301 CDD:418707 46/202 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000250|UniProtKB:P59267 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 334..335
NPxY-like endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.