DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:173 Identity:55/173 - (31%)
Similarity:72/173 - (41%) Gaps:55/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QLPLHPLQIFG-------------WLVLLLFGVASYWVL------IPAFHARIQGPLYGLITGLY 152
            |||..||..|.             :|..|.||....|::      .||    |.|||: ::|...
Mouse    16 QLPSIPLSWFPSSVFAAFNVTLLLFLSGLFFGFPCRWLVQNGEWAFPA----ITGPLF-ILTFFS 75

  Fly   153 LVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHS----HVIE-NGR------CHLCNIRT 206
            ||.:.      .:||.     .:||..        :|..    ||:. |.|      |..|....
Mouse    76 LVSLN------FSDPG-----ILHRGS--------TKEDPMTVHVVRVNQRAFRLEWCPKCLFHR 121

  Fly   207 SSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVS 249
            .. ||.||..||.||..|||||||:|:|||.||:..|::.|:|
Mouse   122 PP-RTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFMLLVLS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 26/51 (51%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 26/56 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.