DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_766053.1 Gene:Zdhhc9 / 208884 MGIID:2444393 Length:364 Species:Mus musculus


Alignment Length:401 Identity:80/401 - (19%)
Similarity:143/401 - (35%) Gaps:109/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GWLVLLLFGVASYWVLIPAFHARIQG-------PLYGLITGLYLVHIASHLTALLTDPA------ 168
            |...|.||.:.....|..||..|...       |::..:  |:|..:|:.|....:||.      
Mouse    36 GIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAM--LFLFSMATLLRTSFSDPGVIPRAL 98

  Fly   169 -DKEL---RRVHRNDRIVPEFDRSK--------HSHVIENGRCHLCNIRTSSNRTKHCSVCNKCV 221
             |:..   ..:...:..||:..|..        ::.:::...|:.|.| ....|..|||:|:.||
Mouse    99 PDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKI-FRPPRASHCSICDNCV 162

  Fly   222 GKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSH 286
            .:|||||.|:.:|:|.|||..|.:.::|..:.|:.:.|   ..||:..::...:.|.....|:..
Mouse   163 ERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFA---FNIVYVALKSLKIGFLETLKETPG 224

  Fly   287 TIESGDFINITLSLSNG-----TMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAII- 345
            |:........||....|     |.::....|:.||: :..|..:.......:...:::|...:: 
Mouse   225 TVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDI-KGSWTGKNRVQNPYSHGNIVKNCCEVLC 288

  Fly   346 ----EASATRPGISPTNHTETQPVVTGIGLNETIFMFLLGVLGLLAAVSAGLLLHLCFFHIYISF 406
                .:...|.||.|...:.::|..|    .||               |:.||..          
Mouse   289 GPLPPSVLDRRGILPLEESGSRPPST----QET---------------SSSLLPQ---------- 324

  Fly   407 LGLTTYEYIRNHRQAQDAKTKQLLEGAPGVRAPKNGNVHFSASLPEPHNPSKSLPGGQQLYCCSS 471
             ...:.|::.::..|:|                        .|:||...|.:             
Mouse   325 -SPASTEHMNSNEMAED------------------------TSIPEEMPPPE------------- 351

  Fly   472 APHPSQHSQES 482
            .|.|.|.:.|:
Mouse   352 PPEPPQEASEA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/82 (34%)
Zdhhc9NP_766053.1 DHHC 138..261 CDD:396215 37/127 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364 19/127 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.