DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and si:ch211-223a10.1

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_009305694.1 Gene:si:ch211-223a10.1 / 101884554 ZFINID:ZDB-GENE-090313-86 Length:544 Species:Danio rerio


Alignment Length:386 Identity:81/386 - (20%)
Similarity:130/386 - (33%) Gaps:150/386 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ISTAGLTES---HSESPAKGVVTPVRKPHSLGSED-----------SPENI---------IPGEQ 69
            |:|..|.|:   |...|....|||:....|.|:.|           |||.:         :..|:
Zfish   119 IATQYLWETRMFHFSDPDNYQVTPLHLAASTGNTDVVRYLLRANRCSPEAVDHQGATALHVAAEK 183

  Fly    70 A---------------------ETNKKPLHLCRLSQLVSYQ--SNIADVQHRKGRRLHGLQLPLH 111
            .                     .|...||.||.......:|  |.|.....::.:.|    :|..
Zfish   184 GMIEVCWLLLKSAGLHILHMTNHTGLTPLDLCNQGNTFRHQQLSKILTDFSQQPKNL----IPKD 244

  Fly   112 PLQIFGWLVLL--LFGVA---------SYW-----VLIP--------AFH-----ARIQGP---- 143
            ...::.|::||  |.|||         .|.     ||.|        .:|     .|:..|    
Zfish   245 SYVMYFWMLLLPSLSGVAVLVIAAALGEYGGIFSAVLFPFMAKTILSQYHRLSSFQRLPNPVYLG 309

  Fly   144 -------------LYGLITGLYLVHIASHLT-------------ALLTDPADKELRRVHRNDRIV 182
                         ||.:|...:..|...||:             .|...|.  :|:....:.|. 
Zfish   310 TLTAGLIHSTVCFLYKIIPSFWPAHTLLHLSLVHFCVLAGLFWKVLKQSPG--QLKDADTDSRF- 371

  Fly   183 PEFDRSKHSHVIENGR-----CHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVA 242
                 |....::|.|:     |..|.:....| .|||.:|:.|:..:||||.::|.|:|..|:..
Zfish   372 -----SSIGDLMEAGQSPDRFCIYCELIQVEN-CKHCRLCDMCIKDYDHHCLFINQCVGRENHRT 430

  Fly   243 FLMCVVSAVVATLVIVAAVVAQIVFYYIQ------PDW------------------LSFYW 279
            |::.::|.|:|.|:.   :::.|.:.|::      .||                  ||.:|
Zfish   431 FILFLMSMVMAHLIF---ILSAIFYLYLKVSGLQLSDWGSVAGREAWVLLLTLLNLLSLFW 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/105 (27%)
si:ch211-223a10.1XP_009305694.1 ANK repeat 7..36 CDD:293786
Ank_2 9..102 CDD:289560
ANK 39..159 CDD:238125 12/39 (31%)
ANK repeat 39..69 CDD:293786
ANK repeat 71..102 CDD:293786
Ank_2 76..162 CDD:289560 12/42 (29%)
ANK repeat 138..170 CDD:293786 9/31 (29%)
Ank_4 139..192 CDD:290365 10/52 (19%)
zf-DHHC 384..509 CDD:279823 28/109 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.