DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc12a

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_002663098.1 Gene:zdhhc12a / 100332332 ZFINID:ZDB-GENE-081104-40 Length:270 Species:Danio rerio


Alignment Length:294 Identity:60/294 - (20%)
Similarity:94/294 - (31%) Gaps:132/294 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PLYGLITGLYLVHIASHLTALLTDP---------------ADKELRRVHRNDRIVPEFDRSKHSH 192
            ||  :.:.:.|:.:..:.|..|.||               .|:||      :.::|:...|    
Zfish    46 PL--VFSSVLLLSVLLYFTVSLMDPGFVLSDSQTETASGDGDEEL------EAMIPQEQNS---- 98

  Fly   193 VIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFL--MCVVSAVVATL 255
             |:..||..|.: ....|.:||..|.:||.:|||||.|:::|:|..|:..||  :||....|.  
Zfish    99 -IKQRRCGYCFL-LQPMRARHCKWCKRCVRRFDHHCPWIDNCVGELNHRWFLLYLCVQFTAVC-- 159

  Fly   256 VIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSLSNGTMMLIEQHTSEEDVHQE 320
                        :.:|..|..|...|:                                    .:
Zfish   160 ------------WGLQSAWSGFISAPS------------------------------------WQ 176

  Fly   321 MWDEEQANMTISTLPTLLENFTAIIEASATRPGISPTNHTETQPVVTGIGLNETIFMFLLGVLGL 385
            .|                  ||..:                                |||....:
Zfish   177 QW------------------FTQNV--------------------------------FLLVAFAV 191

  Fly   386 LAAVSAGLLLHLCFFHIYISFLGLTTYEYIRNHR 419
            .|..|..|||.|| .|.|::.:..||:|::..||
Zfish   192 TAVFSVVLLLLLC-IHAYLASVNCTTWEFMSRHR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 25/84 (30%)
zdhhc12aXP_002663098.1 DHHC 104..221 CDD:396215 44/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.