DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and slc66a1l

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001123690.1 Gene:slc66a1l / 100170445 XenbaseID:XB-GENE-5794175 Length:303 Species:Xenopus tropicalis


Alignment Length:332 Identity:61/332 - (18%)
Similarity:114/332 - (34%) Gaps:101/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GLQLPLHPLQIFGWLVLLLFGVASYWVLIP-----AFHARIQGPLYGLITGLYLVHIASHLTALL 164
            |.:.|||.|.:....| .|.|....|.|:.     |:.      .:.:|.|  ||.||..|.|.|
 Frog     5 GPRHPLHALPLESGAV-CLEGSPWIWQLLQQCVENAWE------YWSVIVG--LVSIACFLFAAL 60

  Fly   165 TDPADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCK 229
                 .:|...|.|.|:    |::.....:      ||                           
 Frog    61 -----PQLYVAHTNGRV----DQALSLGFL------LC--------------------------- 83

  Fly   230 WLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWL---SFYWCPTESSHTIESG 291
            ||     ..::..|:.|.::..:...:|.|       .:|:..|.:   .|.:...:::....:|
 Frog    84 WL-----GGDFTNFIGCYLTNQLPLQIITA-------IFYVNMDIIMISQFSYYKLKNNRLKGNG 136

  Fly   292 D---------FINITLSLSNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAIIEA 347
            .         .:.||||:...:.:|::::....||     :..|.::.|:.:...:..:.:.:..
 Frog   137 SLKGICISWVLLAITLSILLPSQLLLKKYDKNTDV-----EISQKSLGITEMSGFICGYVSSVFY 196

  Fly   348 SATR-PGISPTNHTETQPVVTGIGLNETIFMFLLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTT 411
            ..:| |.:....|.::..       ..:..:|.|.:|| .......|||.|       ..:|...
 Frog   197 LGSRFPQLYKNFHRKSTE-------GTSYLLFALAMLG-NCTYGTSLLLKL-------PAVGHHM 246

  Fly   412 YEYIRNH 418
            .:||.:|
 Frog   247 SQYIMHH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 11/85 (13%)
slc66a1lNP_001123690.1 PQ-loop 44..103 CDD:282099 20/107 (19%)
PQ-loop 185..238 CDD:282099 9/60 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.