DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc16

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_031760679.1 Gene:zdhhc16 / 100145301 XenbaseID:XB-GENE-957764 Length:371 Species:Xenopus tropicalis


Alignment Length:115 Identity:34/115 - (29%)
Similarity:46/115 - (40%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSHV 193
            ||.:|           ||   ...|:.|..|....:|.|               |.:.....:.:
 Frog   110 YWHVI-----------YG---HWNLIMIVFHYYKAITTP---------------PGYPSQMETDI 145

  Fly   194 IENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAF 243
            .....|..| |.....||.|||:|::||.|.||||.|||:|:|..|:..|
 Frog   146 PSVSICRKC-IAHKPARTHHCSICSRCVLKMDHHCPWLNNCVGHYNHRYF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 23/45 (51%)
zdhhc16XP_031760679.1 DHHC 150..299 CDD:396215 23/46 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.