DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc20b

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_005162815.2 Gene:zdhhc20b / 100001188 ZFINID:ZDB-GENE-091117-30 Length:409 Species:Danio rerio


Alignment Length:251 Identity:57/251 - (22%)
Similarity:92/251 - (36%) Gaps:94/251 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KGRRLHGLQLPLHPLQI----FGWLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIAS- 158
            :|||   ...|.|.|:.    ..|:.::...:...|            ..|..:..|.|:.|:| 
Zfish    28 QGRR---KMAPTHVLRCCQRGLAWIPVIFIALVVCW------------SYYAYVVELCLLTISST 77

  Fly   159 ----------HLT----------ALLTDPA----------------DKELRRVHRNDRI------ 181
                      ||:          .:.|.||                :||.|...:.:.:      
Zfish    78 GEKIVYLVVFHLSFVMFVWSYWKTIFTKPANPSKEFCLPKSEKEQYEKEQRPETQQEILKKVATS 142

  Fly   182 VPEFDRS--------KHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSR 238
            :|.:.|:        ....||:..|||            |||.|:.||.|.||||.|:|:|:|..
Zfish   143 LPLYTRTGAGAIRYCDRCQVIKPDRCH------------HCSACDMCVLKMDHHCPWVNNCVGFS 195

  Fly   239 NYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYW--CPTESSHTIESGD 292
            ||..|::.:..::|..|.|.|:|:.    |:|:      :|  |..:|:......|
Zfish   196 NYKFFILFLTYSLVYCLFIAASVLQ----YFIK------FWTLCRRKSAENCPKSD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 29/84 (35%)
zdhhc20bXP_005162815.2 zf-DHHC 44..342 CDD:327686 51/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.