DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dus1 and T26G10.9

DIOPT Version :10

Sequence 1:NP_608507.1 Gene:Dus1 / 33190 FlyBaseID:FBgn0031238 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001254986.1 Gene:T26G10.9 / 13190789 WormBaseID:WBGene00206422 Length:83 Species:Caenorhabditis elegans


Alignment Length:97 Identity:27/97 - (27%)
Similarity:38/97 - (39%) Gaps:21/97 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VVQQVRA---KYEPFHKGEVPYEPEQMAAGSEEDLPLSPWLCQPYIRASPESHRQKIAEKVREAE 376
            |||::..   :|:|..|..|       ||||...      :|    |||.:.....:.....|.:
 Worm     5 VVQRILGADQEYDPRGKATV-------AAGSVLQ------IC----RASADRKELFVIISRSENQ 52

  Fly   377 DPNRTKRQYFDKDGKEISRKRMKKLRRRQRRP 408
            .|.||.|....:|....|.....| |:.:|||
 Worm    53 PPRRTVRNRRKRDSYSPSSSTAPK-RKPKRRP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dus1NP_608507.1 DUS_like_FMN 29..259 CDD:239200
T26G10.9NP_001254986.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.