DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13693 and WIT1

DIOPT Version :9

Sequence 1:NP_608505.1 Gene:CG13693 / 33187 FlyBaseID:FBgn0031235 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_196700.2 Gene:WIT1 / 831010 AraportID:AT5G11390 Length:703 Species:Arabidopsis thaliana


Alignment Length:410 Identity:88/410 - (21%)
Similarity:166/410 - (40%) Gaps:73/410 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DFRNFT---EEERQLRLSSLDAIDMLHTIEQVHNDVATLRLENHIMVEFL--EKNDPKLLLGLRQ 109
            ||.:|.   ||:.:...|::|..|          |.|...||..::...|  |..:.:.|||..|
plant    82 DFESFVSKKEEDEEEPSSNVDDDD----------DSAEKALEFDLLSSILNSEVKELESLLGFLQ 136

  Fly   110 RRTSILR-KLQTKRGSAQGSHGVNSRHSSSKRSIPMSVNQLVSISGISAPEKR--RGMDYKLNFK 171
            ......| .:...:...:....:..:.:.:::|:...:.|:|.:...|:..:|  .|:|.:.::.
plant   137 NEIQSARVMISPFQHDGEAFLDLEGKLNDTEQSLGQLMEQVVEMKKQSSNFQRLSSGLDEQGSWS 201

  Fly   172 AKAEMAEKR-------AAEVEKRVADIERNAMTEVKQLRAKIEELRFRSEETIETENNFMLHFLR 229
            .......:.       :|::..:.||.:||.:..:::..||..||..:..|:..||....:....
plant   202 GGQTSVSQNDGEFGDLSAKINMQTADQQRNVLRMLEKSLAKEMELEKKLSESRNTERELEMKLYS 266

  Fly   230 DENDVAFLESATERQIERKLRKFTSNWFKNARALLGTMKLTIVSLQETCQQHRADLITKSDLSGI 294
            .|.||.::|..||....|.|....:     |....||.|.....||          |.:.:|||.
plant   267 SEQDVVYMEEVTEDAFSRWLEADNA-----AEVFKGTSKEMSGKLQ----------ILQFNLSGS 316

  Fly   295 LTAVD--FEKLIIKRTEL------VNQLEEKNIHMAGL-----KGVTGKTSLAMTEEKQAMMNLE 346
            ....|  ..||:..:..|      :::|:..|..:|..     :|:  |.||...|||..::|.|
plant   317 FKREDNLKSKLVDSKERLEAKECALHKLDSSNARLADFLVAQTEGL--KESLQEAEEKLILLNTE 379

  Fly   347 TEMRTVLNRTDEVTRAIQKLEKEVAAVQMHNTKD--------YVTLDELRAQLQDYEAPSVSEYI 403
                   |.|  ::..:..||:::....: .|:|        ...|:.:..:|:|..|.:.:...
plant   380 -------NST--LSEKVSSLEEQLNEYGI-QTEDADATSGALITDLERINEELKDKLAKTEARAE 434

  Fly   404 ERKEEAHVLEKEEKMLQRKI 423
            |.:.:..:||:.:|.||.::
plant   435 ETESKCKILEESKKELQDEL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13693NP_608505.1 DUF4201 258..432 CDD:290581 42/187 (22%)
WIT1NP_196700.2 SMC_prok_B 81..>397 CDD:274008 76/350 (22%)
Smc <245..585 CDD:224117 55/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.