DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13693 and ccdc113

DIOPT Version :9

Sequence 1:NP_608505.1 Gene:CG13693 / 33187 FlyBaseID:FBgn0031235 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001006061.1 Gene:ccdc113 / 450041 ZFINID:ZDB-GENE-041010-163 Length:358 Species:Danio rerio


Alignment Length:272 Identity:68/272 - (25%)
Similarity:119/272 - (43%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 NFKAKAEMAEKRAAEVEKRVADIERNAMTEVKQLRAKIEELRFRSEETIETENNFMLHFLRDEND 233
            |:||..|.|:...||::|..:..:||.          :|||..:...|:..|.  ::.::.|:  
Zfish   113 NYKATLEEADIHLAEIKKERSHFKRNI----------VEELEDKKSMTMSAEK--VMRYIEDK-- 163

  Fly   234 VAFLESATERQIERKLRKFTSNWFKNARALLGTMKLTIVSLQETCQQHRADLITKSDLSGILTAV 298
                ..|.:..||:..||.:        |||...|           :.:|.|..:.:::..:|.:
Zfish   164 ----IKAKDILIEKLHRKNS--------ALLTHKK-----------KQQAQLRQQEEMAEGVTVL 205

  Fly   299 DFEKLIIKRTELVNQLEEKNIHMAGLKGVTGKTSLAMTEEKQAMMNLETEMRTVLNRTDEVTRAI 363
            |||.|..:......||:|:|:....||.:..||...:...|:.:..|..|...:.:.|...|:.:
Zfish   206 DFELLKFENIRFRKQLDEQNLKQVNLKLLAVKTLQTLNSNKEKLHILTNESEMLSSDTALRTKLL 270

  Fly   364 QKLEKEVAAVQMHNTKDYVTLDELRAQLQDYEAPSVSEYIERKEEAHVLEKEEKMLQRKIYILNM 428
            .|:|:|....:....|......:||.||.|:..|.|.:||:.||....|:|..:..:||:.|..|
Zfish   271 VKIEEETEQAEEERHKAEALNRKLRDQLADFHVPHVLQYIKLKESHGQLQKSVREWERKVEIAEM 335

  Fly   429 KLNNAIRRRNRL 440
            .|....:..::|
Zfish   336 ALKTYTKSWDKL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13693NP_608505.1 DUF4201 258..432 CDD:290581 46/173 (27%)
ccdc113NP_001006061.1 DUF4201 164..339 CDD:290581 51/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9870
eggNOG 1 0.900 - - E1_28MPJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5267
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412900at33208
OrthoFinder 1 1.000 - - FOG0009309
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105099
Panther 1 1.100 - - LDO PTHR15654
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.