DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kis and RGD1310166

DIOPT Version :9

Sequence 1:NP_001137761.1 Gene:kis / 33185 FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster
Sequence 2:XP_220804.5 Gene:RGD1310166 / 303395 RGDID:1310166 Length:235 Species:Rattus norvegicus


Alignment Length:122 Identity:27/122 - (22%)
Similarity:47/122 - (38%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  3609 RFI---RELEA-QIQRTIKLEAFNAEKAEKLAAAEKDAATEKAAATEKAAAEKAAS---VKNEVI 3666
            ||:   .|||| |::|..|....|......:|....||......|.::.:..:..|   :...:.
  Rat   114 RFVSLFSELEAKQLRRLYKYTKTNQTAKFLVALCPLDAPERSLLANQEDSLPRLCSAWGLHGNIS 178

  Fly  3667 DLDDELMTNESVIKKESPVTPIKEEIKSEESPEKHDTADNLEDKNSDAEESTKIKGK 3723
            .:.:.|...::         |.:|.|..:||...|.:.|:|    ....:..|:|.|
  Rat   179 GMKERLSKMQA---------PGQEAILLDESRSSHCSRDSL----MKLPQKPKLKKK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kisNP_001137761.1 BASP1 1554..1786 CDD:283191
HepA 1676..2527 CDD:223627
SDA1 <1693..>1854 CDD:283052
CHROMO <1879..1919 CDD:237991
Chromo 1941..1996 CDD:278797
DEXDc 2048..2197 CDD:238005
Helicase_C 2350..2464 CDD:278689
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
RGD1310166XP_220804.5 DUF4208 50..132 CDD:290618 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.