Sequence 1: | NP_001137761.1 | Gene: | kis / 33185 | FlyBaseID: | FBgn0266557 | Length: | 5517 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005257090.1 | Gene: | C17orf64 / 124773 | HGNCID: | 26990 | Length: | 279 | Species: | Homo sapiens |
Alignment Length: | 279 | Identity: | 62/279 - (22%) |
---|---|---|---|
Similarity: | 98/279 - (35%) | Gaps: | 88/279 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 5173 GGSAGGGGSSASGSTSHSSSKRQREQDAFKQQMDY--YTKTLGLGSGISLIPTSSAGGSSASSSA 5235
Fly 5236 ANAAAAAYAAALDAE--QQHQQQQKALSKRARGDLH-----PTKEELAALAAGLPLNLG------ 5287
Fly 5288 ---------------------ASMSSIE-KSLRGGSSSSSSSTPA----------PMTAEQDKVT 5320
Fly 5321 LTPLNASGGGSGSSSSSAAAAGLAANLPSQTTITIAPPISSGASTSSERSERSESRISLTITNA- 5384
Fly 5385 -------ADAAKLPPPYEE 5396 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kis | NP_001137761.1 | BASP1 | 1554..1786 | CDD:283191 | |
HepA | 1676..2527 | CDD:223627 | |||
SDA1 | <1693..>1854 | CDD:283052 | |||
CHROMO | <1879..1919 | CDD:237991 | |||
Chromo | 1941..1996 | CDD:278797 | |||
DEXDc | 2048..2197 | CDD:238005 | |||
Helicase_C | 2350..2464 | CDD:278689 | |||
RR_TM4-6 | 3728..>3877 | CDD:283990 | |||
BRK | 4569..4613 | CDD:197800 | |||
C17orf64 | XP_005257090.1 | DUF4208 | 85..165 | CDD:290618 | 16/81 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0384 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |