DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kis and C17orf64

DIOPT Version :9

Sequence 1:NP_001137761.1 Gene:kis / 33185 FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster
Sequence 2:XP_005257090.1 Gene:C17orf64 / 124773 HGNCID:26990 Length:279 Species:Homo sapiens


Alignment Length:279 Identity:62/279 - (22%)
Similarity:98/279 - (35%) Gaps:88/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  5173 GGSAGGGGSSASGSTSHSSSKRQREQDAFKQQMDY--YTKTLGLGSGISLIPTSSAGGSSASSSA 5235
            ||....|.:.|.|..: :.|:||.:..|.....::  ..:|....:.:|.:.|||      |:|.
Human     8 GGRWVAGEARADGGPT-ALSRRQAKNRATLSGDNWARAQRTRRKVTNVSCLETSS------SASP 65

  Fly  5236 ANAAAAAYAAALDAE--QQHQQQQKALSKRARGDLH-----PTKEELAALAAGLPLNLG------ 5287
            |..:...:|..||.:  :..::..:.|.|..| .||     |.|::|..:...|.: ||      
Human    66 ARDSLMRHAKGLDQDTFKTCKEYLRPLKKFLR-KLHLPRDLPQKKKLKYMKQSLVV-LGDHINTF 128

  Fly  5288 ---------------------ASMSSIE-KSLRGGSSSSSSSTPA----------PMTAEQDKVT 5320
                                 :..|.:| |.||.....:.||.||          |.|||.|.:.
Human   129 LQHYCQAWEIKHWRKMLWRFISLFSELEAKQLRRLYKYTKSSQPAKFLVRRKTFRPSTAEGDILR 193

  Fly  5321 LTPLNASGGGSGSSSSSAAAAGLAANLPSQTTITIAPPISSGASTSSERSERSESRISLTITNA- 5384
            |                ..|..:.|..|.:.:....|  ..||:...:|.|      ...:.:| 
Human   194 L----------------GCAGEVLAGRPGRQSAQALP--CMGAAQQHQRHE------GAAVQHAD 234

  Fly  5385 -------ADAAKLPPPYEE 5396
                   |.|||:|.|.:|
Human   235 PRSREPPAWAAKIPGPCQE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kisNP_001137761.1 BASP1 1554..1786 CDD:283191
HepA 1676..2527 CDD:223627
SDA1 <1693..>1854 CDD:283052
CHROMO <1879..1919 CDD:237991
Chromo 1941..1996 CDD:278797
DEXDc 2048..2197 CDD:238005
Helicase_C 2350..2464 CDD:278689
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
C17orf64XP_005257090.1 DUF4208 85..165 CDD:290618 16/81 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.