DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and USP6NL

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_006717605.1 Gene:USP6NL / 9712 HGNCID:16858 Length:856 Species:Homo sapiens


Alignment Length:310 Identity:78/310 - (25%)
Similarity:125/310 - (40%) Gaps:69/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 LPDRQ-RVERGHPL---TETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVWKFLLNYYLW 391
            |||.. .|||...|   ..|:||:......:..::.:....|::|..:| ||.|||..||     
Human    84 LPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPLQ-LRGEVWALLL----- 142

  Fly   392 SDTHVERIERRKQKSIEYYN-MKAQWLAMTTTQEANFCGYRERKC-----QIEKDVKRTDRSLQF 450
                  .|.:.|:::.:.|: :|                :|.|.|     ||:.||.||.|....
Human   143 ------EIPKMKEETRDLYSKLK----------------HRARGCSPDIRQIDLDVNRTFRDHIM 185

  Fly   451 FAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFVGFMELVFTNFD 515
            |..........|..:|..|.:||.::||.||||.:.| :|.:.:||.|.||..|..       |.
Human   186 FRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITA-LLLMYMNEEDAFWALVKL-------FS 242

  Fly   516 IDQAGMKTQFAQ-IRRLIEFAN------APLFNYMRSH-DSDNMYFCFRWLLVWYKRELNSEDVL 572
            ..:..|...|.| ..:|:.|..      ....:.::.| ||..:|..| :.:.|:          
Human   243 GPKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSF-YTMKWF---------- 296

  Fly   573 KLWECLWTRLPCPNFHLLFSVAILDQETRVIIDSQYEFTEI-LKHVNELS 621
              ::|...|.|......::.:.|.:.| ||:....|...:: .||:.:||
Human   297 --FQCFLDRTPFTLNLRIWDIYIFEGE-RVLTAMSYTILKLHKKHLMKLS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 59/242 (24%)
USP6NLXP_006717605.1 TBC 125..340 CDD:214540 66/264 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.