DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and USP6

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001291213.1 Gene:USP6 / 9098 HGNCID:12629 Length:1406 Species:Homo sapiens


Alignment Length:194 Identity:43/194 - (22%)
Similarity:83/194 - (42%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 DSELETLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLR 378
            ::||..:.|::.|.:     |:.:.|     .::|:|..........|:::.:.::: |:..::|
Human    53 ETELPPVTAREAKKI-----RREMTR-----TSKWMEMLGEWETYKHSSKLIDRVYK-GIPMNIR 106

  Fly   379 PEVWKFLLNYY---LWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEANFCGYRERKCQIEKD 440
            ..||..|||..   |.:....:.::.|.::|.|:.:                        .|:.|
Human   107 GPVWSVLLNIQEIKLKNPGRYQIMKERGKRSSEHIH------------------------HIDLD 147

  Fly   441 VKRTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFV 504
            |:.|.|:..||..........|..||:.|..||.::||.:.:|.:.|..| :.:.|.|.||..|
Human   148 VRTTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSHITALFL-LYLPEEDAFWALV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 34/139 (24%)
USP6NP_001291213.1 TBC 97..312 CDD:214540 34/140 (24%)
DUF4607 <332..407 CDD:292024
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..380
UBP12 <528..1114 CDD:227847
Peptidase_C19 533..>723 CDD:271592
Peptidase_C19 <1023..1367 CDD:271592
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1120..1231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1384..1406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.