DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and BUB2

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_013771.1 Gene:BUB2 / 855077 SGDID:S000004659 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:134 Identity:35/134 - (26%)
Similarity:54/134 - (40%) Gaps:31/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 YVQGMSDLLAPIL-----EIQVNEVDTFWCFVGFMELVFTNFDIDQAGMKTQFAQIR----RLIE 533
            |||||:.||||:|     |....::.|..|:......:..|.:..|.|.|.....:|    :|.:
Yeast   130 YVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKLLDISLRIIDPKLSK 194

  Fly   534 FANAPLFNYMRSHDSDNM----YFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFH--LLFS 592
            |.            |||:    .:....:|.........:.|:|||:.::..    .||  :||.
Yeast   195 FL------------SDNLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAY----GFHMNILFV 243

  Fly   593 VAIL 596
            ||.|
Yeast   244 VAFL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 35/134 (26%)
BUB2NP_013771.1 COG5210 <1..304 CDD:227535 35/134 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.