DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and TBC1D10A

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001191169.1 Gene:TBC1D10A / 83874 HGNCID:23609 Length:515 Species:Homo sapiens


Alignment Length:466 Identity:96/466 - (20%)
Similarity:165/466 - (35%) Gaps:123/466 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 RSPKSRPGVLISGDRQT---SPDNYQIIGLSGSTNSACSSNG-------------QSRGGSAEKS 311
            |:|.:  |..:||.|::   .||......|| |..|...:||             .|:|  ||.:
Human    11 RAPAA--GESLSGTRESLAQGPDAATTDELS-SLGSDSEANGFAERRIDKFGFIVGSQG--AEGA 70

  Fly   312 PA-------DSELETLNAQDEKIVNNLPDRQRVERGHPLTETQWLE-FQTPDGRISDSARIKELI 368
            |.       :..||.|             |||        |::||: ....|..::...:...|.
Human    71 PCPLLHRLEEVPLEVL-------------RQR--------ESKWLDMLNNWDKWMAKKHKKIRLR 114

  Fly   369 FRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQK--SIEYYNMKAQWLAMTTTQEANFCGYR 431
            .:.|:..|||...|::|      |...| ::::...|  .::......:||.:            
Human   115 CQKGIPPSLRGRAWQYL------SGGKV-KLQQNPGKFDELDMSPGDPKWLDV------------ 160

  Fly   432 ERKCQIEKDVKRTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNE 496
                 ||:|:.|.....:.|..........|..:|..|.:|..:.||.|..:. :|.:|.:.:..
Human   161 -----IERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQAP-IAAVLLMHMPA 219

  Fly   497 VDTFWCFVGFMELVFTNF-----DIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFR 556
            ...|||.|...|.....:     :..|...:..|:.::::...|:    .::.....|.:.:...
Human   220 EQAFWCLVQICEKYLPGYYSEKLEAIQLDGEILFSLLQKVSPVAH----KHLSRQKIDPLLYMTE 280

  Fly   557 WLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFSVAIL-------DQETRVIIDSQYEFTEIL 614
            |.:..:.|.|....||::|:..:    |....::|.|.::       ..|.......|||..|.|
Human   281 WFMCAFSRTLPWSSVLRVWDMFF----CEGVKIIFRVGLVLLKHALGSPEKVKACQGQYETIERL 341

  Fly   615 KHVNELSGNIDVQKTLQVAEGIYLQLKGSETLPNDIRSIIGEPLLPAAAGEEIDG---------- 669
            :   .||..| :|:...|.|.:        .||...|.|..|.|:.....:|..|          
Human   342 R---SLSPKI-MQEAFLVQEVV--------ELPVTERQIEREHLIQLRRWQETRGELQCRSPPRL 394

  Fly   670 ----GMVDEEP 676
                .::|.||
Human   395 HGAKAILDAEP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 43/242 (18%)
TBC1D10ANP_001191169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 12/37 (32%)
TBC 117..320 CDD:214540 43/235 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..515 2/3 (67%)
ZipA <403..>502 CDD:331990 2/3 (67%)
Binding to the PDZ domain of EBP50 512..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.