DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and si:dkeyp-19e1.3

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_005170766.1 Gene:si:dkeyp-19e1.3 / 553000 ZFINID:ZDB-GENE-081104-56 Length:736 Species:Danio rerio


Alignment Length:444 Identity:99/444 - (22%)
Similarity:172/444 - (38%) Gaps:104/444 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 DSELETLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLR 378
            :.||.|..|.:||.     ..|.:||     |.:|::......:..:|.::.:.::: |:...||
Zfish    52 EEELPTPTAVEEKY-----KLQEMER-----EEKWIKMVKKWEKYHNSEKMMKRVYK-GIPLKLR 105

  Fly   379 PEVWKFLLNYYLWSDTHVERIERRKQKSI-EYYNMKAQWLAMTTTQEANFCGYRERKCQIEKDVK 442
            .:.|..||:           :|:.||.:. :|..||.|....:|          |.| ||:.||.
Zfish   106 GQAWALLLD-----------VEKVKQANFRKYEKMKEQAKRYST----------EIK-QIDLDVN 148

  Fly   443 RTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFVGFM 507
            ||.|:...|..........|..:|..|.:||.::.|.||||. :|.||.:.:||.|.||.    :
Zfish   149 RTFRNHIMFMERFGVKQQALFHVLAAYSVYNTEVSYCQGMSQ-IAAILLMYMNEEDAFWA----L 208

  Fly   508 ELVFTNFDIDQAGM------KTQFAQIR--RLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYKR 564
            ..:.||......|.      |....|:.  :::....:.|.|::.........:..:|.|     
Zfish   209 SQLLTNQKHAMHGFFIPGFPKLHRFQVHHDKILSKLLSKLRNHLEKEQMSTGIYTTKWFL----- 268

  Fly   565 ELNSEDVLKLWECLWTRLPCPNFHLLFSVAILDQETRVIIDSQYEFTEI-LKHVNELSGNIDVQK 628
                       :|...|.|......|:.:.||:.| :|:....|...:: .||:.:||.. |:::
Zfish   269 -----------QCFIDRTPFTLTLRLWDIYILEGE-KVLTAMAYTLLKLHKKHLLKLSLE-DLRE 320

  Fly   629 TLQ--------VAEGI---YLQLKGSE------TLP-----NDIRSI-IGE-------------- 656
            .||        :::.:   :||...||      .||     ::...| :||              
Zfish   321 FLQERTASSFNMSDDVVIEHLQSSMSELRRMKLDLPPPGKGDEFPKIPLGEERLIELLSVIQTER 385

  Fly   657 -PLLPAAAGEEIDGGMVDEEPTYSDDGFDELVKELTPEEKVRQQALLEEACERS 709
             ||..||...:....:..|:.|..:...::.:..:|......||:.|..:...|
Zfish   386 VPLPSAAHNNQAASKLQTEDTTSHNQCSNKPIPRITSSSSFSQQSQLPSSSSLS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 57/237 (24%)
si:dkeyp-19e1.3XP_005170766.1 TBC 96..301 CDD:214540 59/249 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.