DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and TBC1D13

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_060671.3 Gene:TBC1D13 / 54662 HGNCID:25571 Length:400 Species:Homo sapiens


Alignment Length:383 Identity:83/383 - (21%)
Similarity:129/383 - (33%) Gaps:136/383 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 RIKELIFRGGVVQ-SLRPEVWKFLLNYYLWSDTHVERIERRKQKSI-----EYYNMKAQWLAMTT 421
            :::||.|.|...: .||...||.||||.        .:||....||     |.|   ||:|....
Human    25 KLRELSFSGIPCEGGLRCLCWKILLNYL--------PLERASWTSILAKQRELY---AQFLREMI 78

  Fly   422 TQ----EANFCGYRER-------------------------KCQIEKDVKRTDRSLQFF-AGEDN 456
            .|    :||....||.                         ..||:|||:|....:.|| ...|.
Human    79 IQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRATDY 143

  Fly   457 PNLTLL----------------------------------------------------------- 462
            |.|.:|                                                           
Human   144 PCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSVPSSLNEYEVLPNGCEAHW 208

  Fly   463 ---QGILMTYVMYNFDLGYVQGMSDLLAPILEI----------QVNEVDTFWCFVGFMELVFTNF 514
               :.||..|...|..:.|||||::::.|:...          :..|.|||:||...|..:..||
Human   209 EVVERILFIYAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNF 273

  Fly   515 ----DIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYKRELNSEDVLKLW 575
                |..|.|:..:..::...::..:..|:..::..:....:|.||||.:...:|....||:::|
Human   274 IKSLDDSQCGITYKMEKVYSTLKDKDVELYLKLQEQNIKPQFFAFRWLTLLLSQEFLLPDVIRIW 338

  Fly   576 ECLWTRLPCPNFHLLFSVAIL----------DQETRVIIDSQYEFT---EILKHVNEL 620
            :.|:......:|.||...|:|          |....:.:...|..|   :||:...||
Human   339 DSLFADDNRFDFLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKEL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 74/350 (21%)
TBC1D13NP_060671.3 TBC 32..367 CDD:214540 73/345 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.