DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and CG8155

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:284 Identity:91/284 - (32%)
Similarity:141/284 - (49%) Gaps:40/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 ETLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVW 382
            :..|..:|.:. |||.|.      |:.::::..|....|:|.....:..:||.||:..|||..||
  Fly   179 KAFNLSEEHMA-NLPPRP------PMCDSEFRLFLDALGQIQRKDELHRVIFLGGIDPSLRRVVW 236

  Fly   383 KFLLNYY------LWSDTHVERIERRKQKSIEYYNMKAQW------------LAMTTTQEANFCG 429
            |.|||.|      |..|.| :|:|..::||.:|..::..|            ||..|:       
  Fly   237 KHLLNVYPGGANGLALDGH-QRMEFMRRKSEQYCRLRDTWKAAVKRGSVAGELAYVTS------- 293

  Fly   430 YRERKCQIEKDVKRTDRSLQFFAG-EDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQ 493
                  .::|||.||||...|:|| :||.|:..|..||.||.:.:..:.|.|||||:.:|:|...
  Fly   294 ------MVKKDVLRTDRLHPFYAGSDDNQNIAALFNILTTYALNHPSVSYCQGMSDIASPLLVTM 352

  Fly   494 VNEVDTFWCFVGFMELVFTNFDIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFRWL 558
            .:|...:.||...|..:..||.:|...|..:||.:...:.|.:...:.|::|..:|::.||:|||
  Fly   353 NDEAQAYICFCAIMSRMRGNFMLDGIAMTQKFAHLTEALSFYDPEFWEYLKSQQADDLLFCYRWL 417

  Fly   559 LVWYKRELNSEDVLKLWECLWTRL 582
            |:..|||...||.|::.|..|:.|
  Fly   418 LLELKREFPFEDALRMLEVQWSSL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 80/233 (34%)
CG8155NP_611029.3 TBC 225..439 CDD:214540 77/227 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456566
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.