DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and RN-tre

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:308 Identity:65/308 - (21%)
Similarity:122/308 - (39%) Gaps:55/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 DGRISDSARIKELIFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQWLAM 419
            |.|:..:...:|:  ....::..|.:.|..:||.  |.... :::.:|..|.|........|..:
  Fly    57 DSRLPSTRDAQEV--HRNKIEMERDKKWMKMLNQ--WPPPQ-DKLHKRVYKGIPDRVRMVAWNKL 116

  Fly   420 TTTQEA--NFCG-----------YRERKCQIEKDVKRTDRSLQFFAGEDNPNLTLLQGILMTYVM 471
            ...|::  |..|           |.....||:.||.|..|....|....:.....|..:|..|.:
  Fly   117 LDIQQSINNNAGVYLRMLQLARKYSTETRQIDADVNRQFRDNLAFRERYSVKQCSLFNVLNAYSI 181

  Fly   472 YNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFVGFMELVFTNFDIDQAGMKTQ-FAQIRRLIEFA 535
            ||.:|||.|||: .:|.:|.:.::|.:.||.    :..:.|:......|:..: |.::.|.|:..
  Fly   182 YNSELGYCQGMA-CVAGVLLLYLHEEEAFWA----LNTLITDQKYGMHGLFIEGFPKLTRFIDHH 241

  Fly   536 NAPLFNYMR-------SHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFSV 593
            :..:...||       .|:.|.:.:..:|..|.:...:.....|::|:                :
  Fly   242 DRIMSKIMRKLHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLRVWD----------------I 290

  Fly   594 AILDQETRVIIDSQYEFTEILKHVNELSGNIDVQKTLQVAEGIYLQLK 641
            .:||.: |||:  ....|.:..|.:||....|:...::     |||::
  Fly   291 FMLDGD-RVIL--SMAITILYLHKDELLRLKDMDAIIE-----YLQVR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 50/249 (20%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 51/238 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456561
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.