DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and Tbc1d21

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001014232.1 Gene:Tbc1d21 / 363072 RGDID:1310243 Length:336 Species:Rattus norvegicus


Alignment Length:330 Identity:75/330 - (22%)
Similarity:142/330 - (43%) Gaps:33/330 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 NNLPDRQRV-----ERGHPLTETQWLEFQTPDGRISDSAR-IKELIFRGGVVQSLRPEVWKFLLN 387
            |:|..|:..     ::..|:.:.:|..|...:|.::.|.. |...|...|:...:|.:.||||..
  Rat     8 NSLSARRSATFILEKKNPPIDKAEWDSFFDENGHLAKSRDFICVNILERGLHPLVRADAWKFLTG 72

  Fly   388 YYLWSDTHVERI----ERRKQKSIEYYNMKAQWLAMTTTQEANFCG-YRERKCQIEKDVKRTDRS 447
            ||.|..:..||:    .||:.     ||...|..........|..| :.|.:..|..|:::    
  Rat    73 YYSWQSSRDERLMVDSNRRRN-----YNSLCQMYEKIQPLLENLHGNFTETRNNIVYDIQK---- 128

  Fly   448 LQFFAGEDNPNL-----TLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQV-NEVDTFWCFVGF 506
              .:..:...|:     .|.:.:|::||. |....|.:|..:::. :.::.| ::.:|||.|..|
  Rat   129 --LYDKDPLGNVLVDKKKLEKTLLLSYVC-NTKAEYQRGFHEMVM-LFQLMVEHDHETFWLFQFF 189

  Fly   507 MELVFTNFDIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYKRELNS-ED 570
            ::....:..|: .|:......:..||...:....::::...|..:...|.|..:.::|...| :|
  Rat   190 LQKTEHSCVIN-IGVGKNLDMLNNLITLLDPQFADHLKGKGSGAVQSLFPWFCLCFQRAFKSFDD 253

  Fly   571 VLKLWECLWTRLPCPNFHLLFSVAILDQETRVIIDSQYEFTEILKHVNELSGNIDVQKTLQVAEG 635
            |.:|||.|.|..||.||.:|.:.::|.......:........||...|:|. ::|..:.:..|..
  Rat   254 VWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQALLESMSGDAILMACNKLI-DLDADELISAACV 317

  Fly   636 IYLQL 640
            :|.:|
  Rat   318 VYSEL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 57/240 (24%)
Tbc1d21NP_001014232.1 RabGAP-TBC 62..287 CDD:295329 56/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.