DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and CG4041

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster


Alignment Length:369 Identity:77/369 - (20%)
Similarity:125/369 - (33%) Gaps:76/369 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 RVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIE 400
            |:.:|:|.|..|.......|                 |...||..:|..||          |.:.
  Fly   412 RLLQGYPHTAEQLQREAAVD-----------------VPPLLRGPIWAALL----------EVVP 449

  Fly   401 RRKQKSIEYYNMKAQWLAMTTTQEANFCGYRERKCQIEKDVKRTDRSLQFFAGEDNPNLTLLQGI 465
            ......|:.:       ..|:|..           |||.|:.|..:..:..:..|...  .|:.:
  Fly   450 NGSYAKIDKF-------TSTSTDR-----------QIEVDIPRCHQYDELLSSPDGHR--KLRRL 494

  Fly   466 LMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVD-TFWCFVGFMELVFTNFDI--DQAGMKTQFAQ 527
            |..:|..:....|.||:..|.||.|.:..|..: .|.....|:......|.:  :.|.:|...::
  Fly   495 LKAWVTAHPQYVYWQGLDSLTAPFLYLNFNNEELAFLSLFKFIPKYLQWFFLKDNSAVIKEYLSK 559

  Fly   528 IRRLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFS 592
            ..:|..|....|..::.|.......|...|.|..:........:|.||:.|  .|...::.|...
  Fly   560 FSQLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWDKL--MLGDSSYPLFIG 622

  Fly   593 VAILDQETRVIIDSQYEFTEILKHVNELSGNIDVQKTLQVAEGIYLQ-LKGSETLPNDIRSIIGE 656
            :|||.|....::.|  .|.|.:...::|.   |:     |.:|..|: .|..|..|..|..  .:
  Fly   623 IAILRQLRSTLLTS--GFNECILLFSDLP---DI-----VMDGCVLESQKMYEATPKSITH--RQ 675

  Fly   657 PLLPAAAGEEIDGGMVDEEPTYSDDGFDELVKELTPEEKVRQQA 700
            ..|.....:.:|.|:.|.|           :|.|..|:..|..|
  Fly   676 HALRLQPPQALDIGVADVE-----------LKHLQQEQCPRISA 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 48/231 (21%)
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 49/233 (21%)
RHOD_Kc 706..810 CDD:238783 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.