DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and CG3703

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster


Alignment Length:314 Identity:59/314 - (18%)
Similarity:111/314 - (35%) Gaps:54/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DQHLIENAETSRSGGEVYAILTTENQKLKKTFAELDIGQIKASQLPRESWLPNKLAGILG-NIPD 255
            :..:.|..||..|...:...|.....:.:....|:::.| :..:|..|.|.|      || |..|
  Fly     2 EMKMAEAQETKDSCSTIEGQLPAGPVRAEDEEEEVEVEQ-EQQELLSERWSP------LGANYDD 59

  Fly   256 ----------YVQPPFQRSPKSRPGVLISGDRQTSPDNYQIIGLSGSTNSACS--SNGQSRGGSA 308
                      .::|..::|...|........|..|.:..|.: |:.|..:..|  ::.|.|....
  Fly    60 ANSASSGVDCELEPGLEKSEARRGSTGSELARLRSIEEEQEL-LTSSLLALTSHFAHVQLRVRQI 123

  Fly   309 EKSPADSELETLNAQDEKIVNNLPDRQRVERGHP-LTETQWLEFQTPDGRI-----SDSARIKEL 367
            .::||:...:.|...::.....:||..:.:..|| ...:...:...||.::     |....::::
  Fly   124 VEAPAEERDQLLRDLEDFAFQGIPDAVQSKESHPDKPASDGEKDHGPDSQLIQQLKSQLTELEQI 188

  Fly   368 IFRGG----VVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEAN-- 426
            .:..|    :.|.:..|..||:|          :.:..:....:|.:.:.|........|..|  
  Fly   189 AYEAGEPGILPQHVLLEKQKFIL----------DELRAKLNLQVEQHELPALSTEQLRHQVDNAI 243

  Fly   427 --FCGYRERKCQIEKDVKRTDRSLQFF---------AGEDNPNLTLLQGILMTY 469
              |.|..:.|.|:...:|.....|:.|         .|.....|.||.|...:|
  Fly   244 GEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDAIEGSVGDRLKLLSGAYNSY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 23/118 (19%)
CG3703NP_569874.1 RUN 516..703 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.