DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and SGSM1

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001035037.1 Gene:SGSM1 / 129049 HGNCID:29410 Length:1148 Species:Homo sapiens


Alignment Length:485 Identity:129/485 - (26%)
Similarity:211/485 - (43%) Gaps:75/485 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RDQHLIENAETSRSGGEVYAILTTENQKLKKTFAELDIGQIKASQLPRESWLPNKLAGILGNIPD 255
            ||..:...:..|.|.|.....|.:::....:.|..:|    :..|:..|..|..|          
Human   699 RDSTISNESSQSCSSGRQNIRLHSDSSSSTQVFESVD----EVEQVEAEGRLEEK---------- 749

  Fly   256 YVQPPFQRSPKSRPGVLISGDRQTSPDNYQIIGLSGSTNSACSSNGQSRGGSAEKSPADSELE-- 318
                    .||...|.|::|  ..|||       ||..:|...|:|.|.......|..||.|:  
Human   750 --------QPKIPNGNLVNG--TCSPD-------SGHPSSHNFSSGLSEHSEPSLSTEDSVLDAQ 797

  Fly   319 -----TLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISD---SARIKELIFRGGVVQ 375
                 .|..:|    .::.|||..|......|....|....|...||   :..:.|.:...|.:.
Human   798 RNTPTVLRPRD----GSVDDRQSSEATTSQDEAPREELAVQDSLESDLLANESMDEFMSITGSLD 858

  Fly   376 SLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQW-----LAMTTTQEANFCG------ 429
            ...||....::..:..|:|........:....|...|::.:     ||:||:  ||...      
Human   859 MALPEKDDVVMEGWRSSETEKHGQADSEDNLSEEPEMESLFPALASLAVTTS--ANEVSPVSSSG 921

  Fly   430 ----------YRERKCQIEKDVKRTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSD 484
                      |.....:|||||:|.||:..:|.   ..||..|:.|:.:|:..:.::||||||.|
Human   922 VTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFT---PANLEKLRNIMCSYIWQHIEIGYVQGMCD 983

  Fly   485 LLAPILEIQVNEVDTFWCFVGFMELVFTNFDIDQAGMKTQFAQIRRLIEFANAPLFNYMRSH-DS 548
            ||||:|.|..:|...|.||...|:.:..||....| |.|.||.:|.||:..::.||..|..: |.
Human   984 LLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGA-MDTHFANMRSLIQILDSELFELMHQNGDY 1047

  Fly   549 DNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFH--LLFSVAILDQETRVIIDSQYEFT 611
            .:.|||:||.|:.:||||..:||..:||.:|......:.|  |..::|:::....:|:::..:||
Human  1048 THFYFCYRWFLLDFKRELVYDDVFLVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFT 1112

  Fly   612 EILKHVNELSGNIDVQKTLQVAEGIYLQLK 641
            :|:|..||::...:.::.|::|..:..:::
Human  1113 DIIKFFNEMAERHNTKQVLKLARDLVYKVQ 1142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931 129/485 (27%)
TBC 369..598 CDD:214540 78/252 (31%)
SGSM1NP_001035037.1 RUN 44..188 CDD:280855
PH_RUTBC 254..425 CDD:275431
Important for interaction with RAB9A and RAB9B. /evidence=ECO:0000250|UniProtKB:Q8BPQ7 256..297
Required for interaction with RAP family members 301..350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..411
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..830 36/164 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 871..894 3/22 (14%)
TBC <936..1105 CDD:214540 64/172 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.