DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and TBC1D3E

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001278395.1 Gene:TBC1D3E / 102723859 HGNCID:27071 Length:549 Species:Homo sapiens


Alignment Length:194 Identity:42/194 - (21%)
Similarity:82/194 - (42%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 DSELETLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLR 378
            ::||..|.|::.|.:     |:.:.|     :::|::......:...|.::.:..:: |:..::|
Human    54 ETELPPLTAREAKQI-----RREISR-----KSKWVDMLGDWEKYKSSRKLIDQAYK-GMPMNIR 107

  Fly   379 PEVWKFLLN---YYLWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEANFCGYRERKCQIEKD 440
            ..:|..|||   ..|.:....:.::.:.:||.|:..                        :|::|
Human   108 GPMWSVLLNTEEMKLKNPGRYQIMKEKGKKSSEHIQ------------------------RIDRD 148

  Fly   441 VKRTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFV 504
            |..|.|...||..........|..||:.|..||.::||.:.:|.:.|..| :.:.|.|.||..|
Human   149 VSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFL-LYLPEEDAFWALV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 33/139 (24%)
TBC1D3ENP_001278395.1 TBC 99..312 CDD:214540 33/139 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.