DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and TBC1D3K

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_006722298.1 Gene:TBC1D3K / 101060351 HGNCID:51245 Length:610 Species:Homo sapiens


Alignment Length:266 Identity:61/266 - (22%)
Similarity:108/266 - (40%) Gaps:52/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 GILGNIPDYVQ-------PPFQRSPKSRPGVLISGDRQTSPDNYQIIGLSGSTNSACSSNGQSRG 305
            ||:.:.|.:..       |||   |...||:....:|..:...:......|...:.|||:     
Human    50 GIVQSCPSWESAPQEGPCPPF---PVPSPGLSPELERDRASPFWGSAPRLGPLQAPCSSS----- 106

  Fly   306 GSAEKSP-ADSELETLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIF 369
             :....| :::||..|.|::.|.:     |:.:.|     :::|::......:...|.::.:..:
Human   107 -ALPGLPYSETELPPLTAREAKQI-----RREISR-----KSKWVDMLGDWEKYKSSRKLIDRAY 160

  Fly   370 RGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSI-EYYNMKAQWLAMTTTQEANFCGYRER 433
            : |:..::|..:|..|||           ||..|.|:. .|..||.:....:           |.
Human   161 K-GMPMNIRGPMWSVLLN-----------IEEMKLKNPGRYQIMKEKGKKSS-----------EH 202

  Fly   434 KCQIEKDVKRTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVD 498
            ..:|::||..|.|...||..........|..||:.|..||.::||.:.:|.:.|..| :.:.|.|
Human   203 IQRIDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFL-LYLPEED 266

  Fly   499 TFWCFV 504
            .||..|
Human   267 AFWALV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 37/137 (27%)
TBC1D3KXP_006722298.1 TBC 160..373 CDD:214540 37/137 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.