DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and tbc1d25

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_031746851.1 Gene:tbc1d25 / 100495342 XenbaseID:XB-GENE-876960 Length:651 Species:Xenopus tropicalis


Alignment Length:392 Identity:116/392 - (29%)
Similarity:187/392 - (47%) Gaps:60/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RSGGEVYAILTTENQKLKKTFA---------ELDIGQIKASQLPRESWLPNKLAGILGNIPDYVQ 258
            :.|.|.|..|.:| ..|...||         ::||...:.|.| .|.|             |.: 
 Frog    21 KQGHETYLALVSE-WDLANAFAAASQPFLQLKIDIKPSEDSPL-LEDW-------------DII- 69

  Fly   259 PPFQRSPKSRPGV-LISGDRQTSPDNYQIIGLSGSTNSACSSNGQSRGGSAEKSPADSELETLNA 322
                 |||...|. |..||::.      :......|.|..|..|::      .:.....|....:
 Frog    70 -----SPKDVIGTDLFVGDKRA------LASALPFTQSILSQVGRT------LTRVQQALSWTYS 117

  Fly   323 QDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVWKFLLN 387
            .|.|     |.:.      ||:::::..:.:.:|:::....::..|:.|||..|||..||::|||
 Frog   118 DDVK-----PFKP------PLSDSEFHTYLSHEGQLTRPEELRLRIYHGGVEPSLRKVVWRYLLN 171

  Fly   388 YYLWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEANFCGYRERKCQIEKDVKRTDRSLQFFA 452
            .|....:..||::..|.|:.|||.:|.:||.....::..|.     :..:.|||.||||:..::|
 Frog   172 VYPDGLSGQERMDYMKCKTREYYQLKGEWLQRCGAEDLEFI-----QGNVMKDVLRTDRTHPYYA 231

  Fly   453 G-EDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFVGFMELVFTNFDI 516
            | ||||:|..|..:|.||.:.:..:.|.|||||:.:|||.:..||...|.||.|.|:.:..||.:
 Frog   232 GSEDNPHLQALHDLLSTYAVTHPQVSYCQGMSDIASPILAVMDNEAHAFICFCGIMKRLEGNFRM 296

  Fly   517 DQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWTR 581
            |...|..:|..::.|:..::....:|:.|..:|::.||:||||:..|||...||.|::.|.:|:.
 Frog   297 DGECMSVKFCHLKLLLRHSDPDFHSYLLSRGADDLLFCYRWLLLELKREFAFEDALRMLEVMWSS 361

  Fly   582 LP 583
            ||
 Frog   362 LP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 82/216 (38%)
tbc1d25XP_031746851.1 TBC 153..366 CDD:214540 82/216 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.