DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and HMLALPHA2

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_009866.1 Gene:HMLALPHA2 / 850292 SGDID:S000000572 Length:210 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:27/87 - (31%)
Similarity:38/87 - (43%) Gaps:22/87 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLA 65
            ::|||:|.|..|                      ||.:..|:|:.|..:..||||...:..:.|.
Yeast   124 INKSTKPYRGHR----------------------FTKENVRILESWFAKNIENPYLDTKGLENLM 166

  Fly    66 AETGLTYTQICNWFANWRRKLK 87
            ..|.|:..||.||.:|.|||.|
Yeast   167 KNTSLSRIQIKNWVSNRRRKEK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 13/37 (35%)
HMLALPHA2NP_009866.1 HOX 135..188 CDD:197696 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.