DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and KNAT3

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_197904.1 Gene:KNAT3 / 832593 AraportID:AT5G25220 Length:431 Species:Arabidopsis thaliana


Alignment Length:89 Identity:31/89 - (34%)
Similarity:41/89 - (46%) Gaps:13/89 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRK- 85
            ||:....||.|  ...|...:||.|.....:.|||:.|:|.:|..||||...||.|||.|.|:: 
plant   340 EEILRKRRAGK--LPGDTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRN 402

  Fly    86 ----------LKNSEREKAKKSWG 99
                      |||..:..|..:.|
plant   403 WHSNPSSSTVLKNKRKSNAGDNSG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 27/71 (38%)
KNAT3NP_197904.1 KNOX1 160..197 CDD:461051
KNOX2 217..267 CDD:427506
ELK 322..343 CDD:427504 2/2 (100%)
Homeobox_KN 363..401 CDD:428673 17/37 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.