DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and meis3

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_571853.1 Gene:meis3 / 81885 ZFINID:ZDB-GENE-010406-2 Length:415 Species:Danio rerio


Alignment Length:97 Identity:31/97 - (31%)
Similarity:49/97 - (50%) Gaps:20/97 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDI-KRMLKDWLIRRRENPYPSREEKKQLA 65
            |:|.|.:||.:                   ||...|.: ..:::.||.:...:||||.|:||||:
Zfish   246 DESDRDRRNNK-------------------KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLS 291

  Fly    66 AETGLTYTQICNWFANWRRKLKNSEREKAKKS 97
            .:||||..|:.|||.|.||::.....::..:|
Zfish   292 QDTGLTILQVNNWFINARRRIVQPMIDQTNRS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 20/37 (54%)
meis3NP_571853.1 Meis_PKNOX_N 91..173 CDD:293102
Homeobox_KN 272..311 CDD:283551 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.