DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and BLH4

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001324137.1 Gene:BLH4 / 816908 AraportID:AT2G23760 Length:679 Species:Arabidopsis thaliana


Alignment Length:130 Identity:31/130 - (23%)
Similarity:49/130 - (37%) Gaps:33/130 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GPSPTPDMPKVDNPLK---------TIVDLVDKERGFAPVKQPSPVLGVQKKAVSVSSTPTVQPV 205
            ||:.......|..|.|         ::|.||.:|:         ...|:...:||..:...::.|
plant  1287 GPNYVGSFQAVCTPCKDSKSETGSLSLVSLVPEEK---------VSFGLYALSVSSLTVARIRKV 1342

  Fly   206 VNGTSTLRKVSATQL--PNHNGTTTVIQIQNA------PSRNVATA-----AVSTPVTKPAITSM 257
            .|...:  |..|.||  .:|...|.|..:.|:      |:|.:..|     .|.|.|.||..|::
plant  1343 YNKLDS--KAIAKQLAISSHENATPVKLLHNSAGHLNGPARTIGAALIGYLGVRTFVPKPVATTL 1405

  Fly   258  257
            plant  1406  1405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039
BLH4NP_001324137.1 POX 233..370 CDD:214728
Homeobox_KN <503..533 CDD:428673
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.