DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and IRX6

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_077311.2 Gene:IRX6 / 79190 HGNCID:14675 Length:446 Species:Homo sapiens


Alignment Length:238 Identity:64/238 - (26%)
Similarity:90/238 - (37%) Gaps:63/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL- 86
            ||..|.|  ::..|.:....||.||...|:||||::.||..||..|.:|.||:..||||.||:| 
Human   143 ELSGAGR--RKNATRETTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK 205

  Fly    87 -----------KNSEREKA----KKSWGHLIKN-----YNHNARGNVEQFSISSEDSIWEEEMHS 131
                       |..|..||    :.|.|.|..:     .:..|||    ..:|..:.:.|||...
Human   206 KENKMTWAPKNKGGEERKAEGGEEDSLGCLTADTKEVTASQEARG----LRLSDLEDLEEEEEEE 266

  Fly   132 CPAEDDE-----GDDNEEFSSHSTGSDGN---------------------ANNEPSSPYKPILFV 170
            ..|||:|     ||...||...:....|.                     :.|:||...:     
Human   267 EEAEDEEVVATAGDRLTEFRKGAQSLPGPCAAAREGRLERRECGLAAPRFSFNDPSGSEE----- 326

  Fly   171 GSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQGTQ 213
                 .:.:||:||......|....:..|..|.|.|.:....:
Human   327 -----ADFLSAETGSPRLTMHYPCLEKPRIWSLAHTATASAVE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
IRX6NP_077311.2 Homeobox_KN 164..203 CDD:283551 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..273 17/68 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..394 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.