DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and TGIF1

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_775299.1 Gene:TGIF1 / 7050 HGNCID:11776 Length:286 Species:Homo sapiens


Alignment Length:253 Identity:64/253 - (25%)
Similarity:89/253 - (35%) Gaps:88/253 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLA 65
            :|.|:.....:|. ||...|:|.:                ::|:|||...|.|.|||.:||..|:
Human    39 LDLSSSAGSGKRR-RRGNLPKESV----------------QILRDWLYEHRYNAYPSEQEKALLS 86

  Fly    66 AETGLTYTQICNWFANWRRKLKNSEREKAKKSWGHLIKNYNHNARGNVEQFSIS------SEDSI 124
            .:|.|:..|:||||.|.||:|......|..|               :..||:||      ||.|.
Human    87 QQTHLSTLQVCNWFINARRRLLPDMLRKDGK---------------DPNQFTISRRGAKISETSS 136

  Fly   125 WEEEM---HSCPAEDDEGDDNEEFSSHSTGSDGN------ANNEPSSPYK--------------- 165
            .|..|   :..||       .||...||..:..|      .:.:||||..               
Human   137 VESVMGIKNFMPA-------LEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTA 194

  Fly   166 ----PILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRDSS------TAKTTSQQGTQ 213
                |.....|.|:.:....|         |:..|...|:|      |.|:.....||
Human   195 LKDVPFSLCQSVGVGQNTDIQ---------QIAAKNFTDTSLMYPEDTCKSGPSTNTQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
TGIF1NP_775299.1 Homeobox_KN 67..106 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.