DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and PKNOX2

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001369252.1 Gene:PKNOX2 / 63876 HGNCID:16714 Length:472 Species:Homo sapiens


Alignment Length:138 Identity:40/138 - (28%)
Similarity:61/138 - (44%) Gaps:40/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL-------KNSE-REKAKKSW 98
            :::.||.:...:|||:.:||:|:||:|.||..|:.|||.|.||::       .|.: ..||||  
Human   302 IMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPDPAPKAKK-- 364

  Fly    99 GHLIKNY---------NHNARGNVEQ------------------FSISSEDSIWEEEMHSCPAED 136
               ||:.         |..|.|.::|                  .|:||:.:....:.....|.|
Human   365 ---IKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHD 426

  Fly   137 DEGDDNEE 144
            |..|..||
Human   427 DSLDGTEE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 21/54 (39%)
PKNOX2NP_001369252.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
PLN02983 <3..>66 CDD:215533
Meis_PKNOX_N 96..181 CDD:465140
Homeobox_KN 307..345 CDD:428673 18/37 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..371 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 386..405 1/18 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..472 6/13 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.