DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and TGIF2

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001186442.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens


Alignment Length:202 Identity:50/202 - (24%)
Similarity:78/202 - (38%) Gaps:65/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTY 72
            ||.||.:.    |:|.:                ::|:|||...|.|.|||.:||..|:.:|.|:.
Human    18 KRKRRGNL----PKESV----------------KILRDWLYLHRYNAYPSEQEKLSLSGQTNLSV 62

  Fly    73 TQICNWFANWRRKLKNSEREKAKKSWGHLIKNYNHNARG--------------NVEQFSISSEDS 123
            .||||||.|.||:|......|..|.    ...:..:.||              :|...|:.:..:
Human    63 LQICNWFINARRRLLPDMLRKDGKD----PNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTN 123

  Fly   124 IWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNANNEPSSPY--------KPILFVGSAGLTERIS 180
            :....:.|.|....:|:                  :|::|:        ||::..||. ||....
Human   124 VLSLSVCSMPLHSGQGE------------------KPAAPFPRGELESPKPLVTPGST-LTLLTR 169

  Fly   181 AQTGGKT 187
            |:.|..|
Human   170 AEAGSPT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
TGIF2NP_001186442.1 Homeobox_KN 36..75 CDD:399131 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 2/22 (9%)
Repressive function 103..237 16/93 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.