DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Irx4

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_061373.1 Gene:Irx4 / 50916 MGIID:1355275 Length:515 Species:Mus musculus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:102/281 - (36%) Gaps:73/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSE------REKA 94
            |.:....||.||...|:||||::.||..||..|.:|.||:..||||.||:||...      |.|.
Mouse   151 TRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKC 215

  Fly    95 ---KKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNA 156
               |:.:|          .|..|:   :.|:...||.:.|..:|...|.|::|............
Mouse   216 ADEKRPYG----------EGEEEE---AGEEESREEPLKSAKSEGHAGKDDKELELSDLEDFDPL 267

  Fly   157 NNEPS-----SPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQ------ 210
            :.|.|     :|::.:    .:| .|||.|.:.|....|.            |.||.:.      
Mouse   268 DAETSECELKTPFQSL----DSG-PERIPASSDGPGTGKE------------ASTTLRMPLGTAG 315

  Fly   211 GTQLNKWLESAAK------FTPDRNNYHIEWNMTRQKASSNSSCGQAIFTTDVSGA-----GRGG 264
            |..::..||.|..      ..||..            |.......:|..|...:||     .:..
Mouse   316 GAVMDGDLERARNCLRSTVVVPDSG------------AEGGPPACEAKLTFAQAGAPPNLETKPR 368

  Fly   265 RWMLHHKDELEAAEALANLAF 285
            .|.|.|.....||.||:...|
Mouse   369 IWSLAHTATAAAATALSQTEF 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
Irx4NP_061373.1 Homeobox_KN 161..200 CDD:368670 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..258 14/65 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..307 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.