DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and irx2

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001008113.1 Gene:irx2 / 493475 XenbaseID:XB-GENE-480618 Length:456 Species:Xenopus tropicalis


Alignment Length:272 Identity:66/272 - (24%)
Similarity:97/272 - (35%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLK------- 87
            |.::..|.|....||.||...|:||||::.||..||..|.:|.||:..||||.||:||       
 Frog   112 AYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW 176

  Fly    88 ----NSEREKAKKSWGHLIKNYNHNARGNVEQFSISSE------DSIWEEEMHSCPAEDD----- 137
                .||.|...:..|..:|........:..:.|...|      ||:.:   |||.|:.|     
 Frog   177 APRNKSEDEDDDEGDGERVKEEQSEKAQDCNETSAEDEGISLHVDSLTD---HSCSADSDGEKLP 238

  Fly   138 ---------EGDDNEEFSSHSTGSDGNANNEPSSPYKPILFVGSAGLTERI-------SAQTGGK 186
                     .|.:::|........:.....:...|.||.......|:...|       |.:...|
 Frog   239 CRATDHLCESGSESKEKYDDDEDEEEGDEEDRVLPVKPATSSPLTGVEAPILNHQQDGSPRNSNK 303

  Fly   187 TKYKHQMMEKYMRDSSTAK--------TTSQQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKAS 243
            |...:.|.......:|..|        |:..:.:.|...|.||........:|           .
 Frog   304 TSLDNGMSPSSQTPASKPKLWSLAEIATSDHKHSNLGSVLSSATSSAAHNPSY-----------P 357

  Fly   244 SNSSCGQAIFTT 255
            |:|..|:.|:.|
 Frog   358 SSSLLGRHIYYT 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
irx2NP_001008113.1 COG5576 <110..212 CDD:227863 34/99 (34%)
Homeobox_KN 128..167 CDD:368670 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..214 6/41 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..320 11/73 (15%)
IRO 317..333 CDD:214716 3/15 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..456
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.