DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and irx4b

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001018329.2 Gene:irx4b / 474318 ZFINID:ZDB-GENE-040712-4 Length:439 Species:Danio rerio


Alignment Length:239 Identity:62/239 - (25%)
Similarity:95/239 - (39%) Gaps:54/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGH 100
            |.:....||.||...::||||::.||..||..|.:|.||:..||||.||:||    ::.|.:|..
Zfish   147 TRETTSTLKAWLQEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK----KENKMTWSP 207

  Fly   101 LIKNYNH-NARGNVEQFSISSEDSIWEEEMHSCPAEDDEG-DDNEEFSS--------HSTGSD-- 153
            ..||.:. ....:.|....:.|:.|..|:    ...|:.| ||.::..|        .|.||:  
Zfish   208 RNKNSDEKECDDDQEDLDEAQEEPIKTEQ----DFNDNHGKDDTDQLHSDLDDFDLVESDGSECE 268

  Fly   154 ----------GNANNEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTS 208
                      ...::.|.:.:|.       ...|.::..|.|..|:....:.....|...||...
Zfish   269 SKPSFVVHVHSETSDHPETHFKD-------AFHESVTELTRGVHKFSEDRLRAPAEDHQMAKFYL 326

  Fly   209 QQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKASSN----SSC 248
            |||   .|.:|:..|.          |::.:...|.|    |||
Zfish   327 QQG---QKTIETKPKI----------WSLAQTATSLNQVDYSSC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
irx4bNP_001018329.2 Homeobox_KN 157..196 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.