DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and meis3

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001006782.1 Gene:meis3 / 448474 XenbaseID:XB-GENE-485337 Length:453 Species:Xenopus tropicalis


Alignment Length:59 Identity:27/59 - (45%)
Similarity:38/59 - (64%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RATKRLFTPDI-KRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL 86
            |..||...|.: ..:::.||.:...:||||.|:|||||.:||||..|:.|||.|.||::
 Frog   267 RNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 21/37 (57%)
meis3NP_001006782.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..64
Meis_PKNOX_N 102..186 CDD:374576
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..272 2/4 (50%)
Homeobox_KN 285..324 CDD:368670 22/38 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.