DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and meis3

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001006782.1 Gene:meis3 / 448474 XenbaseID:XB-GENE-485337 Length:453 Species:Xenopus tropicalis


Alignment Length:59 Identity:27/59 - (45%)
Similarity:38/59 - (64%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RATKRLFTPDI-KRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL 86
            |..||...|.: ..:::.||.:...:||||.|:|||||.:||||..|:.|||.|.||::
 Frog   267 RNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 27/59 (46%)
meis3NP_001006782.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..64
Meis_PKNOX_N 102..186 CDD:465140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..272 2/4 (50%)
Homeobox_KN 286..324 CDD:428673 21/37 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.