DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and MEIS1

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_002389.1 Gene:MEIS1 / 4211 HGNCID:7000 Length:390 Species:Homo sapiens


Alignment Length:85 Identity:29/85 - (34%)
Similarity:42/85 - (49%) Gaps:16/85 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAA 66
            |.....|..:||.:|.                :|......:::.||.:...:||||.|:|||||.
Human   262 DDDDPDKDKKRHKKRG----------------IFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQ 310

  Fly    67 ETGLTYTQICNWFANWRRKL 86
            :||||..|:.|||.|.||::
Human   311 DTGLTILQVNNWFINARRRI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 21/37 (57%)
MEIS1NP_002389.1 Meis_PKNOX_N 108..192 CDD:406806
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..279 5/32 (16%)
Homeobox_KN 290..329 CDD:399131 22/38 (58%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:26550823, ECO:0000305|PubMed:28473536 299..329 19/29 (66%)
Required for transcriptional activation. /evidence=ECO:0000250 335..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.