DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and irx3

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001001216.1 Gene:irx3 / 407888 XenbaseID:XB-GENE-480486 Length:448 Species:Xenopus tropicalis


Alignment Length:228 Identity:57/228 - (25%)
Similarity:92/228 - (40%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICN 77
            |...|:.|..:......:..:..|.:....||.||...|:||||::.||..||..|.:|.||:..
 Frog    93 HPHAAFYPYGQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVST 157

  Fly    78 WFANWRRKLK---------NSEREKAKKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMHSCP 133
            ||||.||:||         .|..::...::|...:...|.....::..:|.:||...:|::.. |
 Frog   158 WFANARRRLKKENKMTWAPRSRTDEEGNAYGSDHEEDKHEDDEEIDLENIDTEDIESKEDLDD-P 221

  Fly   134 AEDDEGDDNEEFSSHSTGSDGNAN-NEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKY 197
            ..|...|...:..|.|..|||..: |.|.               :|:.....|:.:..::..:..
 Frog   222 DTDIHSDSKTDARSDSEASDGFEDLNAPE---------------DRLLKSVVGQRQVLNEEPQDK 271

  Fly   198 MRDSSTAKTTSQQGTQLNKWLESAAKFTPDRNN 230
            ...||.||.:.....|:.  |:......|..||
 Frog   272 CALSSDAKASQPACEQIK--LDRIPSSPPLENN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
irx3NP_001001216.1 Homeobox_KN 126..165 CDD:310480 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..250 16/79 (20%)
IRO 304..321 CDD:214716
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.