DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and mirr

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:98/288 - (34%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KRNRRHSRRAWPPEEELHP----------------ASRATKRLFTPDIKRMLKDWLIRRRENPYP 56
            |.|.......||.....||                .:.|.::..|.:....||.||...::||||
  Fly   188 KENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRETTSTLKAWLNEHKKNPYP 252

  Fly    57 SREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGHLIKNYNHNARGNV--EQFSIS 119
            ::.||..||..|.:|.||:..||||.||:||    ::.|.:|         ..|..|  :..:|.
  Fly   253 TKGEKIMLAIITKMTLTQVSTWFANARRRLK----KENKMTW---------EPRNRVDDDDANID 304

  Fly   120 SEDSIWEEEMHSCPAED------DEGDDNEEFSSHSTGSDGNANNEPSSPYKPILFVGSAGLTER 178
            .:|....|:.....|:|      |:.|.:.......|...|.:||...|..:|....||..|.:|
  Fly   305 DDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESRPGSPNGSPDLYDR 369

  Fly   179 ISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQGTQLNKWLESAAKFTPDRNNYHIEWN---MTRQ 240
            ..:...|.....|.                   ..|:......|...||...||....   ...|
  Fly   370 PGSMPPGAHPLFHP-------------------AALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ 415

  Fly   241 KASSNSSCGQAIFTTDVSGAGRGGRWML 268
            :|..||      ..|.|.|..:...|.|
  Fly   416 QAQQNS------LQTAVGGTAKPRIWSL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11211
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.