DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and mirr

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster


Alignment Length:158 Identity:36/158 - (22%)
Similarity:64/158 - (40%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TDQ--LMAAIRNGINLK--PAKTNDRSTAAFIKQ-----------ANGVLD----DNDEPAPSVP 91
            |:|  .:|.:|..::.|  |......|..:.:||           |..||.    .|.:.||:||
  Fly   267 TEQGVALAILRGVLDFKRDPWPQISESAKSLVKQMLDPDPTKRLTAQQVLAHPWIQNAKKAPNVP 331

  Fly    92 YDKSTSIDEMKDAL-QAELRNTLKRKIKKQELEEGDCRKNEEIERSIELTRNEVQLKLNGPSPTP 155
            ..     |.::..| |..:.|..|:|:.:...|....::.|.|:....|..::...|:..|....
  Fly   332 LG-----DIVRSRLKQFSMMNRFKKKVLRVIAEHLSIQEVEVIKNMFSLMDDDKDGKITYPELKA 391

  Fly   156 DMPKVDNPL-----KTIVDLVDKE-RGF 177
            .:.||.:.|     |.::::.|.: .||
  Fly   392 GLQKVGSQLGEPEIKMLMEVADVDGNGF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 15/62 (24%)
mirrNP_001261778.1 Homeobox_KN 243..281 CDD:428673 4/13 (31%)

Return to query results.
Submit another query.