DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and ara

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster


Alignment Length:198 Identity:56/198 - (28%)
Similarity:82/198 - (41%) Gaps:35/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKA 94
            |.::..|.:....||.||...::||||::.||..||..|.:|.||:..||||.||:||    ::.
  Fly   257 ARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK----KEN 317

  Fly    95 KKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMH-------SCPAEDDEGDDNEEFSSHSTGS 152
            |.:|..  ||     |.:.:..::.|:|...:|::.       |.....||..:.|:........
  Fly   318 KMTWEP--KN-----RTDDDDDALVSDDEKDKEDLEPSKGSQGSVSLAKDETKEEEDAIDEDQKC 375

  Fly   153 DGNAN------NEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQG 211
            .|.||      ..||:......:.|..|.:   |...||...|.||....|.        ..|||
  Fly   376 LGQANILRAGFGYPSAGSGSGGYPGGGGSS---SGHPGGYHPYHHQHPAYYQ--------AGQQG 429

  Fly   212 TQL 214
            ..|
  Fly   430 GML 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11211
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.